TNFSF18 antibody
-
- Target See all TNFSF18 Antibodies
- TNFSF18 (Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TNFSF18 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TNFSF18 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQN
- Top Product
- Discover our top product TNFSF18 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TNFSF18 Blocking Peptide, catalog no. 33R-4504, is also available for use as a blocking control in assays to test for specificity of this TNFSF18 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFSF18 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNFSF18 (Tumor Necrosis Factor (Ligand) Superfamily, Member 18 (TNFSF18))
- Alternative Name
- TNFSF18 (TNFSF18 Products)
- Synonyms
- Gitrl antibody, AITRL antibody, GITRL antibody, TL6 antibody, hGITRL antibody, TNLG2A antibody, tumor necrosis factor (ligand) superfamily, member 18 antibody, TNF superfamily member 18 antibody, Tnfsf18 antibody, TNFSF18 antibody
- Background
- TNFSF18 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptor TNFRSF18/AITR/GITR. It has been shown to modulate T lymphocyte survival in peripheral tissues. This cytokine is also found to be expressed in endothelial cells, and is thought to be important for interaction between T lymphocytes and endothelial cells.
- Molecular Weight
- 23 kDa (MW of target protein)
-