GHRHR antibody (N-Term)

Catalog No. ABIN634579

Product Details anti-GHRHR Antibody

Target: GHRHR (Growth Hormone Releasing Hormone Receptor (GHRHR))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GHRHR antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GHRHR antibody was raised against the N terminal of GHRHR

Purification: Affinity purified

Immunogen: GHRHR antibody was raised using the N terminal of GHRHR corresponding to a region with amino acids VTLPCPDFFSHFSSESGAVKRDCTITGWSEPFPPYPVACPVPLELLAEEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GHRHR Blocking Peptide, catalog no. 33R-9852, is also available for use as a blocking control in assays to test for specificity of this GHRHR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GHRHR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GHRHR

Target: GHRHR (Growth Hormone Releasing Hormone Receptor (GHRHR))

Alternative Name: GHRHR (GHRHR Products)

Synonyms: GHRFR antibody, GRFR antibody, IGHD1B antibody, Ghrfr antibody, lit antibody, little antibody, GHRHREC antibody, GHRH-R antibody, growth hormone releasing hormone receptor antibody, GHRHR antibody, Ghrhr antibody

Background: GHRHR is a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in its gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Hormone Transport, Regulation of Intracellular Steroid Hormone Receptor Signaling, cAMP Metabolic Process