CALCRL antibody (N-Term)
-
- Target See all CALCRL Antibodies
- CALCRL (Calcitonin Receptor-Like (CALCRL))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CALCRL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CALCRL antibody was raised against the N terminal of CALCRL
- Purification
- Affinity purified
- Immunogen
- CALCRL antibody was raised using the N terminal of CALCRL corresponding to a region with amino acids DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL
- Top Product
- Discover our top product CALCRL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CALCRL Blocking Peptide, catalog no. 33R-1962, is also available for use as a blocking control in assays to test for specificity of this CALCRL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALCRL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CALCRL (Calcitonin Receptor-Like (CALCRL))
- Alternative Name
- CALCRL (CALCRL Products)
- Background
- CALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
- Molecular Weight
- 53 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-