IL-22 antibody (C-Term)
-
- Target See all IL-22 (IL22) Antibodies
- IL-22 (IL22) (Interleukin 22 (IL22))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IL-22 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IL22 antibody was raised against the C terminal of IL22
- Purification
- Affinity purified
- Immunogen
- IL22 antibody was raised using the C terminal of IL22 corresponding to a region with amino acids CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
- Top Product
- Discover our top product IL22 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IL22 Blocking Peptide, catalog no. 33R-1709, is also available for use as a blocking control in assays to test for specificity of this IL22 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL22 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IL-22 (IL22) (Interleukin 22 (IL22))
- Alternative Name
- IL22 (IL22 Products)
- Synonyms
- IL-21 antibody, IL-22 antibody, IL-D110 antibody, IL-TIF antibody, ILTIF antibody, TIFIL-23 antibody, TIFa antibody, zcyto18 antibody, IL-22a antibody, ILTIFa antibody, Iltif antibody, RGD1561292 antibody, interleukin-22 antibody, interleukin 22 antibody, IL22 antibody, il22 antibody, Il22 antibody
- Background
- IL22 belongs to the IL-10 family. It is a cytokine that contributes to the inflammatory response in vivo.
- Molecular Weight
- 20 kDa (MW of target protein)
-