IL-22 antibody (C-Term)

Catalog No. ABIN634575

Product Details anti-IL-22 Antibody

Target: IL-22 (IL22) (Interleukin 22 (IL22))

Binding Specificity: C-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IL-22 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IL22 antibody was raised against the C terminal of IL22

Purification: Affinity purified

Immunogen: IL22 antibody was raised using the C terminal of IL22 corresponding to a region with amino acids CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IL22 Blocking Peptide, catalog no. 33R-1709, is also available for use as a blocking control in assays to test for specificity of this IL22 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL22 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IL-22

Target: IL-22 (IL22) (Interleukin 22 (IL22))

Alternative Name: IL22 (IL22 Products)

Synonyms: IL-21 antibody, IL-22 antibody, IL-D110 antibody, IL-TIF antibody, ILTIF antibody, TIFIL-23 antibody, TIFa antibody, zcyto18 antibody, IL-22a antibody, ILTIFa antibody, Iltif antibody, RGD1561292 antibody, interleukin-22 antibody, interleukin 22 antibody, IL22 antibody, il22 antibody, Il22 antibody

Background: IL22 belongs to the IL-10 family. It is a cytokine that contributes to the inflammatory response in vivo.

Molecular Weight: 20 kDa (MW of target protein)