ATP6V0A2 antibody (N-Term)
-
- Target See all ATP6V0A2 Antibodies
- ATP6V0A2 (ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP6V0A2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP6 V6 2 antibody was raised against the N terminal of ATP6 6 2
- Purification
- Affinity purified
- Immunogen
- ATP6 V6 2 antibody was raised using the N terminal of ATP6 6 2 corresponding to a region with amino acids INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN
- Top Product
- Discover our top product ATP6V0A2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP6V0A2 Blocking Peptide, catalog no. 33R-4080, is also available for use as a blocking control in assays to test for specificity of this ATP6V0A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP6V0A2 (ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2))
- Alternative Name
- ATP6V0A2 (ATP6V0A2 Products)
- Synonyms
- A2 antibody, ARCL antibody, ARCL2A antibody, ATP6A2 antibody, ATP6N1D antibody, J6B7 antibody, RTF antibody, STV1 antibody, TJ6 antibody, TJ6M antibody, TJ6S antibody, VPH1 antibody, WSS antibody, 8430408C20Rik antibody, AI385560 antibody, ATP6a2 antibody, AW489264 antibody, Atp6n1d antibody, Atp6n2 antibody, C76904 antibody, ISF antibody, SHIF antibody, Stv1 antibody, TJ6s antibody, Tj6 antibody, V-ATPase 116 kDa antibody, V-ATPase a2 antibody, Cc1-3 antibody, J6b7 antibody, atp6v0a2 antibody, si:ch211-199i18.4 antibody, si:ch211-106a19.2 antibody, ATPase H+ transporting V0 subunit a2 antibody, ATPase, H+ transporting, lysosomal V0 subunit A2 antibody, ATPase, H+ transporting, lysosomal V0 subunit a2a antibody, ATPase, H+ transporting, lysosomal V0 subunit a2b antibody, ATP6V0A2 antibody, Atp6v0a2 antibody, atp6v0a2a antibody, atp6v0a2b antibody
- Background
- The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells.
- Molecular Weight
- 98 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Proton Transport
-