DGKE antibody (N-Term)
-
- Target See all DGKE Antibodies
- DGKE (Diacylglycerol Kinase, epsilon 64kDa (DGKE))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DGKE antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DGKE antibody was raised against the N terminal of DGKE
- Purification
- Affinity purified
- Immunogen
- DGKE antibody was raised using the N terminal of DGKE corresponding to a region with amino acids EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR
- Top Product
- Discover our top product DGKE Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DGKE Blocking Peptide, catalog no. 33R-2256, is also available for use as a blocking control in assays to test for specificity of this DGKE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGKE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DGKE (Diacylglycerol Kinase, epsilon 64kDa (DGKE))
- Alternative Name
- DGKE (DGKE Products)
- Background
- Diacylglycerol kinases are thought to be involved mainly in the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. When expressed in mammalian cells, DGK-epsilon shows specificity for arachidonyl-containing diacylglycerol. DGK-epsilon is expressed predominantly in testis.
- Molecular Weight
- 64 kDa (MW of target protein)
-