ASB5 antibody (C-Term)
-
- Target See all ASB5 Antibodies
- ASB5 (Ankyrin Repeat and SOCS Box Containing 5 (ASB5))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ASB5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ASB5 antibody was raised against the C terminal of ASB5
- Purification
- Affinity purified
- Immunogen
- ASB5 antibody was raised using the C terminal of ASB5 corresponding to a region with amino acids LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC
- Top Product
- Discover our top product ASB5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ASB5 Blocking Peptide, catalog no. 33R-5157, is also available for use as a blocking control in assays to test for specificity of this ASB5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASB5 (Ankyrin Repeat and SOCS Box Containing 5 (ASB5))
- Alternative Name
- ASB5 (ASB5 Products)
- Background
- They contain ankyrin repeat sequence and SOCS box domain. The SOCSbox serves to couple suppressor of cytokine signalling (SOCS)proteins and their binding partners with the elongin B and Ccomplex, possibly targeting them for degradation.
- Molecular Weight
- 36 kDa (MW of target protein)
-