Heme Oxygenase antibody
HMOX
Reactivity: Human, Mouse, Rat
WB
Host: Rabbit
Polyclonal
unconjugated
1 image
-
- Target See all Heme Oxygenase (HMOX) products
- Heme Oxygenase (HMOX)
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Clonality
- Polyclonal
- Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Heme Oxygenase antibody was raised using a synthetic peptide corresponding to a region with amino acids ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Heme Oxygenase Blocking Peptide, catalog no. 33R-2708, is also available for use as a blocking control in assays to test for specificity of this Heme Oxygenase antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMOX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Heme Oxygenase (HMOX)
- Alternative Name
- Heme Oxygenase (HMOX Products)
- Background
- HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter.
- Molecular Weight
- 33 kDa (MW of target protein)
-
You are here:
