FcRn antibody (N-Term)
-
- Target See all FcRn Antibodies
- FcRn (neonatal Fc Receptor (FcRn))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FcRn antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FCGRT antibody was raised against the N terminal of FCGRT
- Purification
- Affinity purified
- Immunogen
- FCGRT antibody was raised using the N terminal of FCGRT corresponding to a region with amino acids GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE
- Top Product
- Discover our top product FcRn Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FCGRT Blocking Peptide, catalog no. 33R-3667, is also available for use as a blocking control in assays to test for specificity of this FCGRT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCGRT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FcRn (neonatal Fc Receptor (FcRn))
- Alternative Name
- FCGRT (FcRn Products)
- Background
- FCGRT binds to the Fc region of monomeric immunoglobulins gamma. It mediates the uptake of IgG from milk. It plays a possible role in transfer of immunoglobulin G from mother to fetus.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-