HFE antibody (C-Term)
-
- Target See all HFE Antibodies
- HFE (Hemochromatosis (HFE))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HFE antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- HFE antibody was raised against the C terminal of HFE
- Purification
- Affinity purified
- Immunogen
- HFE antibody was raised using the C terminal of HFE corresponding to a region with amino acids FEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS
- Top Product
- Discover our top product HFE Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HFE Blocking Peptide, catalog no. 33R-2879, is also available for use as a blocking control in assays to test for specificity of this HFE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HFE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HFE (Hemochromatosis (HFE))
- Alternative Name
- HFE (HFE Products)
- Background
- HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-