HFE antibody (N-Term)

Catalog No. ABIN634556

Product Details anti-HFE Antibody

Target: HFE (Hemochromatosis (HFE))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HFE antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HFE antibody was raised against the N terminal of HFE

Purification: Affinity purified

Immunogen: HFE antibody was raised using the N terminal of HFE corresponding to a region with amino acids MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HFE Blocking Peptide, catalog no. 33R-6012, is also available for use as a blocking control in assays to test for specificity of this HFE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HFE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HFE

Target: HFE (Hemochromatosis (HFE))

Alternative Name: HFE (HFE Products)

Synonyms: HFE1 antibody, HH antibody, HLA-H antibody, MVCD7 antibody, TFQTL2 antibody, MR2 antibody, hemochromatosis antibody, HFE antibody, Hfe antibody

Background: HFE is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in its gene.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process