ULBP1 antibody (N-Term)
-
- Target See all ULBP1 Antibodies
- ULBP1 (UL16 Binding Protein 1 (ULBP1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ULBP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ULBP1 antibody was raised against the N terminal of ULBP1
- Purification
- Affinity purified
- Immunogen
- ULBP1 antibody was raised using the N terminal of ULBP1 corresponding to a region with amino acids MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC
- Top Product
- Discover our top product ULBP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ULBP1 Blocking Peptide, catalog no. 33R-5583, is also available for use as a blocking control in assays to test for specificity of this ULBP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ULBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ULBP1 (UL16 Binding Protein 1 (ULBP1))
- Alternative Name
- ULBP1 (ULBP1 Products)
- Synonyms
- RAET1I antibody, A430108B07Rik antibody, MULT1 antibody, ULBP1 antibody, UL16 binding protein 1 antibody, UL16 binding protein 21 antibody, NKG2D ligand 1 antibody, ULBP1 antibody, ULBP21 antibody, Ulbp1 antibody, LOC100683099 antibody
- Background
- ULBP1 is the ligand for the NKG2D receptor, together with at least ULBP2 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP1 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-