Tetraspanin 6 antibody (N-Term)
-
- Target See all Tetraspanin 6 (TSPAN6) Antibodies
- Tetraspanin 6 (TSPAN6)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Tetraspanin 6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Tetraspanin 6 antibody was raised against the N terminal of TSPAN6
- Purification
- Affinity purified
- Immunogen
- Tetraspanin 6 antibody was raised using the N terminal of TSPAN6 corresponding to a region with amino acids VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA
- Top Product
- Discover our top product TSPAN6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Tetraspanin 6 Blocking Peptide, catalog no. 33R-9562, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tetraspanin 6 (TSPAN6)
- Alternative Name
- Tetraspanin 6 (TSPAN6 Products)
- Background
- TSPAN6 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2.
- Molecular Weight
- 27 kDa (MW of target protein)
-