Tetraspanin 6 antibody (N-Term)

Catalog No. ABIN634550

Product Details anti-Tetraspanin 6 Antibody

Target: Tetraspanin 6 (TSPAN6)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Tetraspanin 6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Tetraspanin 6 antibody was raised against the N terminal of TSPAN6

Purification: Affinity purified

Immunogen: Tetraspanin 6 antibody was raised using the N terminal of TSPAN6 corresponding to a region with amino acids VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 6 Blocking Peptide, catalog no. 33R-9562, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Tetraspanin 6

Target: Tetraspanin 6 (TSPAN6)

Alternative Name: Tetraspanin 6 (TSPAN6 Products)

Synonyms: GB14865 antibody, TSPAN6 antibody, t245 antibody, tm4sf6 antibody, tspan-6 antibody, DKFZp469J2433 antibody, TM4SF6 antibody, T245 antibody, TSPAN-6 antibody, 6720473L21Rik antibody, AI316786 antibody, Tm4sf antibody, Tm4sf6 antibody, tetraspanin 6 antibody, TSPAN6 antibody, Tspan6 antibody, tspan6 antibody

Background: TSPAN6 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein and is highly similar in sequence to the transmembrane 4 superfamily member 2.

Molecular Weight: 27 kDa (MW of target protein)