ADAM33 antibody (Middle Region)

Catalog No. ABIN634549

Product Details anti-ADAM33 Antibody

Target: ADAM33 (ADAM Metallopeptidase Domain 33 (ADAM33))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM33 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ADAM33 antibody was raised against the middle region of ADAM33

Purification: Affinity purified

Immunogen: ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAM33 Blocking Peptide, catalog no. 33R-3711, is also available for use as a blocking control in assays to test for specificity of this ADAM33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAM33

Target: ADAM33 (ADAM Metallopeptidase Domain 33 (ADAM33))

Alternative Name: ADAM33 (ADAM33 Products)

Synonyms: ADAM13 antibody, ADAM33 antibody, Adaml antibody, adam13 antibody, C20orf153 antibody, DJ964F7.1 antibody, ADAM metallopeptidase domain 33 antibody, disintegrin and metalloproteinase domain-containing protein 19-like antibody, a disintegrin and metallopeptidase domain 33 antibody, ADAM metallopeptidase domain 33 L homeolog antibody, ADAM33 antibody, LOC100230755 antibody, Adam33 antibody, adam33.L antibody

Background: ADAM33 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM33 is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness.

Molecular Weight: 62 kDa (MW of target protein)