GEM antibody (N-Term)

Catalog No. ABIN634547

Product Details anti-GEM Antibody

Target: GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GEM antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GEM antibody was raised against the N terminal of GEM

Purification: Affinity purified

Immunogen: GEM antibody was raised using the N terminal of GEM corresponding to a region with amino acids KEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GEM Blocking Peptide, catalog no. 33R-4348, is also available for use as a blocking control in assays to test for specificity of this GEM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GEM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GEM

Target: GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))

Alternative Name: GEM (GEM Products)

Synonyms: KIR antibody, GEM antibody, DKFZp470D0612 antibody, LOC100221129 antibody, kir antibody, xgem antibody, zgc:153003 antibody, Gem antibody, AV020497 antibody, GTP binding protein overexpressed in skeletal muscle antibody, geminin, DNA replication inhibitor antibody, GTP binding protein (gene overexpressed in skeletal muscle) antibody, GEM antibody, gem antibody, Gem antibody, GMNN antibody

Background: GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.

Molecular Weight: 34 kDa (MW of target protein)