UQCRFS1 antibody (N-Term)

Catalog No. ABIN634545

Product Details anti-UQCRFS1 Antibody

Target: UQCRFS1 (Ubiquinol-Cytochrome C Reductase, Rieske Iron-Sulfur Polypeptide 1 (UQCRFS1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UQCRFS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UQCRFS1 antibody was raised against the N terminal of UQCRFS1

Purification: Affinity purified

Immunogen: UQCRFS1 antibody was raised using the N terminal of UQCRFS1 corresponding to a region with amino acids MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UQCRFS1 Blocking Peptide, catalog no. 33R-6220, is also available for use as a blocking control in assays to test for specificity of this UQCRFS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UQCRFS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UQCRFS1

Target: UQCRFS1 (Ubiquinol-Cytochrome C Reductase, Rieske Iron-Sulfur Polypeptide 1 (UQCRFS1))

Alternative Name: UQCRFS1 (UQCRFS1 Products)

Synonyms: uqcrfs1 antibody, MGC53134 antibody, rip1 antibody, ris1 antibody, risp antibody, uqcr5 antibody, fb78f10 antibody, wu:fb05d11 antibody, wu:fb78f10 antibody, wu:fj05e12 antibody, zgc:73109 antibody, zgc:85614 antibody, GLEAN_00043 antibody, RIP1 antibody, RIS1 antibody, RISP antibody, UQCR5 antibody, 4430402G14Rik antibody, AI875505 antibody, LRRGT00195 antibody, UQCRFSL1 antibody, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 S homeolog antibody, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 antibody, cytochrome b-c1 complex subunit Rieske, mitochondrial antibody, iron-sulfur protein 1 antibody, uqcrfs1.S antibody, uqcrfs1 antibody, LOC661125 antibody, LOC705178 antibody, UQCRFS1 antibody, Uqcrfs1 antibody, LOC100227575 antibody, isp1 antibody

Background: UQCRFS1 is the component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Proton Transport