ADCY10 antibody (N-Term)
-
- Target See all ADCY10 Antibodies
- ADCY10 (Adenylate Cyclase 10 (Soluble) (ADCY10))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADCY10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SAC antibody was raised against the N terminal Of Sac
- Purification
- Affinity purified
- Immunogen
- SAC antibody was raised using the N terminal Of Sac corresponding to a region with amino acids VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL
- Top Product
- Discover our top product ADCY10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SAC Blocking Peptide, catalog no. 33R-9558, is also available for use as a blocking control in assays to test for specificity of this SAC antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADCY10 (Adenylate Cyclase 10 (Soluble) (ADCY10))
- Alternative Name
- SAC (ADCY10 Products)
- Background
- SAC belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.
- Molecular Weight
- 187 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-