GLP2R antibody (N-Term)
-
- Target See all GLP2R Antibodies
- GLP2R (Glucagon-Like Peptide 2 Receptor (GLP2R))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GLP2R antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GLP2 R antibody was raised against the N terminal of GLP2
- Purification
- Affinity purified
- Immunogen
- GLP2 R antibody was raised using the N terminal of GLP2 corresponding to a region with amino acids KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP
- Top Product
- Discover our top product GLP2R Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GLP2R Blocking Peptide, catalog no. 33R-4510, is also available for use as a blocking control in assays to test for specificity of this GLP2R antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLP2R (Glucagon-Like Peptide 2 Receptor (GLP2R))
- Alternative Name
- GLP2R (GLP2R Products)
- Background
- The GLP2 receptor (GLP2R) is a G protein-coupled receptor superfamily member closely related to the glucagon receptor ans GLP1 receptor. Glucagon-like peptide-2 (GLP2) is a 33-amino acid proglucagon-derived peptide produced by intestinal enteroendocrine cells. Like glucagon-like peptide-1 (GLP1) and glucagon itself, it is derived from the proglucagon peptide encoded by the GCG gene. GLP2 stimulates intestinal growth and upregulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. Moreover, GLP2 prevents intestinal hypoplasia resulting from total parenteral nutrition.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Peptide Hormone Metabolism, cAMP Metabolic Process, Feeding Behaviour
-