ADCY6 antibody (C-Term)

Catalog No. ABIN634528

Product Details anti-ADCY6 Antibody

Target: ADCY6 (Adenylate Cyclase 6 (ADCY6))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADCY6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ADCY6 antibody was raised against the C terminal of ADCY6

Purification: Affinity purified

Immunogen: ADCY6 antibody was raised using the C terminal of ADCY6 corresponding to a region with amino acids LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADCY6 Blocking Peptide, catalog no. 33R-5069, is also available for use as a blocking control in assays to test for specificity of this ADCY6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADCY6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADCY6

Target: ADCY6 (Adenylate Cyclase 6 (ADCY6))

Alternative Name: ADCY6 (ADCY6 Products)

Synonyms: ADCY6 antibody, adcy6 antibody, AC6 antibody, mKIAA0422 antibody, ACVI antibody, ADCYB antibody, adenylate cyclase 6 L homeolog antibody, adenylate cyclase 6 antibody, adenylate cyclase 6a antibody, adcy6.L antibody, ADCY6 antibody, adcy6a antibody, adcy6 antibody, Adcy6 antibody

Background: ADCY6 is adenylate cyclase 6, which is a membrane-associated enzyme and catalyzes the formation of the secondary messenger cyclic adenosine monophosphate (cAMP). The expression of ADCY6 is found in normal thyroid and brain tissues, as well as some tumors, and its expression is significantly higher in one hyperfunctioning thyroid tumor than in normal thyroid tissue.

Molecular Weight: 125 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma