FKBP8 antibody (N-Term)
-
- Target See all FKBP8 Antibodies
- FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FKBP8 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FKBP8 antibody was raised against the N terminal of FKBP8
- Purification
- Affinity purified
- Immunogen
- FKBP8 antibody was raised using the N terminal of FKBP8 corresponding to a region with amino acids GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS
- Top Product
- Discover our top product FKBP8 Primary Antibody
-
anti-FK506 Binding Protein 8, 38kDa (FKBP8) antibody
FKBP8 Reactivity: Human WB, IF Host: Rabbit Monoclonal unconjugated
anti-FK506 Binding Protein 8, 38kDa (FKBP8) (AA 58-190) antibodyFKBP8 Reactivity: Human WB, ELISA, IHC Host: Rabbit Polyclonal unconjugated
anti-FK506 Binding Protein 8, 38kDa (FKBP8) (AA 60-270) antibodyFKBP8 Reactivity: Human WB, IP, IF Host: Rabbit Polyclonal unconjugated
anti-FK506 Binding Protein 8, 38kDa (FKBP8) (AA 199-226) antibodyFKBP8 Reactivity: Human WB Host: Rabbit Polyclonal RB27518 unconjugated
anti-FK506 Binding Protein 8, 38kDa (FKBP8) (AA 110-329) antibodyFKBP8 Reactivity: Mouse WB, IHC, ICC Host: Rabbit Polyclonal unconjugated
anti-FK506 Binding Protein 8, 38kDa (FKBP8) (AA 93-339) antibodyFKBP8 Reactivity: Human WB, IHC, IP, ICC Host: Mouse Monoclonal 7-2# unconjugated
anti-FK506 Binding Protein 8, 38kDa (FKBP8) (AA 110-329) antibodyFKBP8 Reactivity: Mouse WB, IHC, IP, ICC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-FK506 Binding Protein 8, 38kDa (FKBP8) (Internal Region) antibodyFKBP8 Reactivity: Human, Mouse, Rat WB, ELISA Host: Rabbit Polyclonal unconjugated
anti-FK506 Binding Protein 8, 38kDa (FKBP8) (AA 110-159) antibodyFKBP8 Reactivity: Human, Mouse, Rat, Dog, Horse, Guinea Pig, Monkey, Bat, Pig WB Host: Rabbit Polyclonal unconjugated
anti-FK506 Binding Protein 8, 38kDa (FKBP8) (AA 326-375) antibodyFKBP8 Reactivity: Human, Mouse, Rat, Dog, Horse, Cow, Guinea Pig, Goat, Zebrafish (Danio rerio), Monkey, Bat, Pig, Xenopus laevis WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FKBP8 Blocking Peptide, catalog no. 33R-3478, is also available for use as a blocking control in assays to test for specificity of this FKBP8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FKBP8 (FK506 Binding Protein 8, 38kDa (FKBP8))
- Alternative Name
- FKBP8 (FKBP8 Products)
- Synonyms
- FKBP8 antibody, fkbp8 antibody, 38kDa antibody, FKBP-38 antibody, FKBP-8 antibody, Fkbp38 antibody, zgc:77672 antibody, FKBP38 antibody, FKBPr38 antibody, FK506 binding protein 8 antibody, FK506 binding protein 8 L homeolog antibody, FKBP8 antibody, fkbp8 antibody, Fkbp8 antibody, fkbp8.L antibody
- Background
- FKBP8 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, it does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- Autophagy
-
