ATL2 antibody (C-Term)

Catalog No. ABIN634521

Product Details anti-ATL2 Antibody

Target: ATL2 (Atlastin GTPase 2 (ATL2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ATL2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARL6 IP2 antibody was raised against the C terminal of ARL6 P2

Purification: Affinity purified

Immunogen: ARL6 IP2 antibody was raised using the C terminal of ARL6 P2 corresponding to a region with amino acids MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARL6IP2 Blocking Peptide, catalog no. 33R-5950, is also available for use as a blocking control in assays to test for specificity of this ARL6IP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL0 P2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ATL2

Target: ATL2 (Atlastin GTPase 2 (ATL2))

Alternative Name: ARL6IP2 (ATL2 Products)

Synonyms: ARL3IP2 antibody, ARL6IP2 antibody, atlastin2 antibody, 2010110I21Rik antibody, AA407293 antibody, AV334690 antibody, Aip-2 antibody, Arl6ip2 antibody, arl6ip2 antibody, ATL2 antibody, fc06e01 antibody, wu:fc06e01 antibody, wu:fv60d03 antibody, atlastin GTPase 2 antibody, atlastin GTPase 2 L homeolog antibody, ATL2 antibody, Atl2 antibody, atl2.L antibody, atl2 antibody

Background: ARL6IP2 is a multi-pass membrane proteinPotential. It belongs to the GBP family. Atlastin GTPases are required for Golgi apparatus and ER morphogenesis.

Molecular Weight: 66 kDa (MW of target protein)