DAP Kinase 1 antibody (N-Term)

Catalog No. ABIN634506

Product Details anti-DAP Kinase 1 Antibody

Target: DAP Kinase 1 (DAPK1) (Death-Associated Protein Kinase 1 (DAPK1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAP Kinase 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DAPK1 antibody was raised against the N terminal of DAPK1

Purification: Affinity purified

Immunogen: DAPK1 antibody was raised using the N terminal of DAPK1 corresponding to a region with amino acids MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAPK1 Blocking Peptide, catalog no. 33R-6570, is also available for use as a blocking control in assays to test for specificity of this DAPK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAPK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAP Kinase 1

Target: DAP Kinase 1 (DAPK1) (Death-Associated Protein Kinase 1 (DAPK1))

Alternative Name: DAPK1 (DAPK1 Products)

Synonyms: DAPK1 antibody, MGC81366 antibody, si:ch211-66i11.1 antibody, wu:fj09c03 antibody, dapk antibody, MGC83745 antibody, 2310039H24Rik antibody, 2810425C21Rik antibody, AI642003 antibody, D13Ucla1 antibody, DAP-Kinase antibody, DAPK antibody, death-associated protein kinase 1 antibody, death associated protein kinase 1 L homeolog antibody, death associated protein kinase 1 antibody, death associated protein kinase 1 S homeolog antibody, LOC427465 antibody, dapk1.L antibody, DAPK1 antibody, dapk1 antibody, dapk1.S antibody, Dapk1 antibody

Background: Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160 kDa calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen

Molecular Weight: 157 kDa (MW of target protein)

Pathways: MAPK Signaling, Interferon-gamma Pathway