TRAF7 antibody (N-Term)
-
- Target See all TRAF7 Antibodies
- TRAF7 (TNF Receptor-Associated Factor 7 (TRAF7))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TRAF7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TRAF7 antibody was raised against the N terminal of TRAF7
- Purification
- Affinity purified
- Immunogen
- TRAF7 antibody was raised using the N terminal of TRAF7 corresponding to a region with amino acids GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR
- Top Product
- Discover our top product TRAF7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TRAF7 Blocking Peptide, catalog no. 33R-3462, is also available for use as a blocking control in assays to test for specificity of this TRAF7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAF7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRAF7 (TNF Receptor-Associated Factor 7 (TRAF7))
- Alternative Name
- TRAF7 (TRAF7 Products)
- Background
- Tumor necrosis factor (TNF) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily.
- Molecular Weight
- 74 kDa (MW of target protein)
-