GADD45B antibody (Middle Region)

Catalog No. ABIN634503

Product Details anti-GADD45B Antibody

Target: GADD45B (Growth Arrest and DNA-Damage-Inducible, beta (GADD45B))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GADD45B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GADD45 B antibody was raised against the middle region of GADD45

Purification: Affinity purified

Immunogen: GADD45 B antibody was raised using the middle region of GADD45 corresponding to a region with amino acids FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GADD45B Blocking Peptide, catalog no. 33R-2851, is also available for use as a blocking control in assays to test for specificity of this GADD45B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GADD40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GADD45B

Target: GADD45B (Growth Arrest and DNA-Damage-Inducible, beta (GADD45B))

Alternative Name: GADD45B (GADD45B Products)

Synonyms: GADD45BETA antibody, MYD118 antibody, AI323528 antibody, Myd118 antibody, CS131 antibody, cb196 antibody, gadd45b antibody, gadd45b2 antibody, sb:cb196 antibody, zgc:73104 antibody, gadd45beta antibody, wu:fa92d10 antibody, wu:fa98h12 antibody, wu:fk65h03 antibody, zgc:111973 antibody, gadd45b1 antibody, gadd45bl antibody, zgc:112453 antibody, growth arrest and DNA damage inducible beta antibody, growth arrest and DNA-damage-inducible 45 beta antibody, growth arrest and DNA-damage-inducible, beta antibody, growth arrest and DNA-damage-inducible, beta a antibody, growth arrest and DNA-damage-inducible, beta b antibody, GADD45B antibody, Gadd45b antibody, gadd45ba antibody, gadd45bb antibody

Background: GADD45B is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth.

Molecular Weight: 18 kDa (MW of target protein)

Pathways: Cell Division Cycle