CD40 antibody (N-Term)
-
- Target See all CD40 Antibodies
- CD40
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CD40 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CD40 antibody was raised against the N terminal of CD40
- Purification
- Affinity purified
- Immunogen
- CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD
- Top Product
- Discover our top product CD40 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CD40 Blocking Peptide, catalog no. 33R-8706, is also available for use as a blocking control in assays to test for specificity of this CD40 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD40 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CD40
- Alternative Name
- CD40 (CD40 Products)
- Synonyms
- Bp50 antibody, CDW40 antibody, TNFRSF5 antibody, p50 antibody, AI326936 antibody, GP39 antibody, HIGM1 antibody, IGM antibody, IMD3 antibody, T-BAM antibody, TRAP antibody, Tnfrsf5 antibody, TNFSF5 antibody, CD40 molecule antibody, CD40 antigen antibody, CD40 antibody, Cd40 antibody
- Background
- CD40 is the receptor for TNFSF5/CD40LG. Defects in CD40 are the cause of hyper-IgM immunodeficiency type 3 (HIGM3).
- Molecular Weight
- 20 kDa (MW of target protein)
- Pathways
- NF-kappaB Signaling, Cellular Response to Molecule of Bacterial Origin, M Phase, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints
-