CHIA antibody (N-Term)

Catalog No. ABIN634493

Product Details anti-CHIA Antibody

Target: CHIA (Chitinase, Acidic (CHIA))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHIA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CHIA antibody was raised against the N terminal of CHIA

Purification: Affinity purified

Immunogen: CHIA antibody was raised using the N terminal of CHIA corresponding to a region with amino acids MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHIA Blocking Peptide, catalog no. 33R-6610, is also available for use as a blocking control in assays to test for specificity of this CHIA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHIA

Target: CHIA (Chitinase, Acidic (CHIA))

Alternative Name: CHIA (CHIA Products)

Synonyms: chia-a antibody, AMCASE antibody, CHIT2 antibody, TSA1902 antibody, 2200003E03Rik antibody, AMCase antibody, YNL antibody, CHIA antibody, chioIIa antibody, fa55g10 antibody, wu:fa55g10 antibody, zgc:63792 antibody, acidic mammalian chitinase antibody, chitinase, acidic antibody, chitinase, acidic S homeolog antibody, chitinase-M31, acidic antibody, chitinase, acidic 1 antibody, chitinase, acidic.4 antibody, LOC703284 antibody, CHIA antibody, LOC100600050 antibody, chia.S antibody, CHIA-M31 antibody, Chia1 antibody, Chia antibody, chia.4 antibody

Background: CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.

Molecular Weight: 40 kDa (MW of target protein)