MASP2 antibody (N-Term)

Catalog No. ABIN634492

Product Details anti-MASP2 Antibody

Target: MASP2 (Mannan-Binding Lectin serine Peptidase 2 (MASP2))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MASP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MASP2 antibody was raised against the N terminal of MASP2

Purification: Affinity purified

Immunogen: MASP2 antibody was raised using the N terminal of MASP2 corresponding to a region with amino acids FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MASP2 Blocking Peptide, catalog no. 33R-3017, is also available for use as a blocking control in assays to test for specificity of this MASP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MASP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MASP2

Target: MASP2 (Mannan-Binding Lectin serine Peptidase 2 (MASP2))

Alternative Name: MASP2 (MASP2 Products)

Synonyms: MAP19 antibody, MASP-2 antibody, MASP1P1 antibody, sMAP antibody, MAp19 antibody, mannan binding lectin serine peptidase 2 antibody, mannan-binding lectin serine peptidase 2 antibody, MASP2 antibody, Masp2 antibody

Background: The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Complement System