C4BPB antibody (N-Term)

Catalog No. ABIN634490

Product Details anti-C4BPB Antibody

Target: C4BPB (Complement Component 4 Binding Protein, beta (C4BPB))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C4BPB antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: C4 BPB antibody was raised against the N terminal of C4 PB

Purification: Affinity purified

Immunogen: C4 BPB antibody was raised using the N terminal of C4 PB corresponding to a region with amino acids CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C4BPB Blocking Peptide, catalog no. 33R-1652, is also available for use as a blocking control in assays to test for specificity of this C4BPB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 PB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C4BPB

Target: C4BPB (Complement Component 4 Binding Protein, beta (C4BPB))

Alternative Name: C4BPB (C4BPB Products)

Synonyms: C4BPB antibody, C4BP antibody, C4bp-ps1 antibody, complement component 4 binding protein beta antibody, complement component 4 binding protein, beta antibody, C4BPB antibody, C4bpb antibody

Background: C4BPB is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Complement System