CFP antibody (N-Term)

Catalog No. ABIN634481

Product Details anti-CFP Antibody

Target: CFP (Complement Factor P (CFP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CFP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CFP antibody was raised against the N terminal of CFP

Purification: Affinity purified

Immunogen: CFP antibody was raised using the N terminal of CFP corresponding to a region with amino acids QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CFP Blocking Peptide, catalog no. 33R-7790, is also available for use as a blocking control in assays to test for specificity of this CFP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CFP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CFP

Target: CFP (Complement Factor P (CFP))

Alternative Name: CFP (CFP Products)

Synonyms: BFD antibody, PFC antibody, PFD antibody, PROPERDIN antibody, BCFG antibody, Pfc antibody, Properdin antibody, complement factor properdin antibody, CFP antibody, Cfp antibody

Background: CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system.

Molecular Weight: 48 kDa (MW of target protein)

Pathways: Complement System