CFP antibody (N-Term)
-
- Target See all CFP Antibodies
- CFP (Complement Factor P (CFP))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CFP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CFP antibody was raised against the N terminal of CFP
- Purification
- Affinity purified
- Immunogen
- CFP antibody was raised using the N terminal of CFP corresponding to a region with amino acids QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS
- Top Product
- Discover our top product CFP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CFP Blocking Peptide, catalog no. 33R-7790, is also available for use as a blocking control in assays to test for specificity of this CFP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CFP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CFP (Complement Factor P (CFP))
- Alternative Name
- CFP (CFP Products)
- Synonyms
- BFD antibody, PFC antibody, PFD antibody, PROPERDIN antibody, BCFG antibody, Pfc antibody, Properdin antibody, complement factor properdin antibody, CFP antibody, Cfp antibody
- Background
- CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Complement System
-