VPREB1 antibody (Middle Region)
-
- Target See all VPREB1 Antibodies
- VPREB1 (Pre-B Lymphocyte 1 (VPREB1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VPREB1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- VPREB1 antibody was raised against the middle region of VPREB1
- Purification
- Affinity purified
- Immunogen
- VPREB1 antibody was raised using the middle region of VPREB1 corresponding to a region with amino acids TIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPP
- Top Product
- Discover our top product VPREB1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VPREB1 Blocking Peptide, catalog no. 33R-9127, is also available for use as a blocking control in assays to test for specificity of this VPREB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPREB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPREB1 (Pre-B Lymphocyte 1 (VPREB1))
- Alternative Name
- VPREB1 (VPREB1 Products)
- Synonyms
- IGI antibody, IGVPB antibody, VPREB antibody, VpreB antibody, CD179a antibody, Vpreb-1 antibody, V-set pre-B cell surrogate light chain 1 antibody, immunoglobulin iota chain antibody, immunoglobulin iota chain-like antibody, pre-B lymphocyte 1 antibody, pre-B lymphocyte gene 1 antibody, VPREB1 antibody, LOC698810 antibody, LOC486411 antibody, Vpreb1 antibody
- Background
- VPREB1 belongs to the immunoglobulin superfamily and is expressed selectively at the early stages of B cell development, namely, in proB and early preB cells.
- Molecular Weight
- 16 kDa (MW of target protein)
- Pathways
- Production of Molecular Mediator of Immune Response, Regulation of Cell Size
-