AIMP1 antibody

Catalog No. ABIN634468

Product Details anti-AIMP1 Antibody

Target: AIMP1 (Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1 (AIMP1))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AIMP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SCYE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAEIQNGVKQIPF

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCYE1 Blocking Peptide, catalog no. 33R-5153, is also available for use as a blocking control in assays to test for specificity of this SCYE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCYE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AIMP1

Target: AIMP1 (Aminoacyl tRNA Synthetase Complex-Interacting Multifunctional Protein 1 (AIMP1))

Alternative Name: SCYE1 (AIMP1 Products)

Synonyms: EMAP2 antibody, EMAPII antibody, HLD3 antibody, SCYE1 antibody, p43 antibody, wu:fa95a05 antibody, zgc:154081 antibody, AIMP1 antibody, 9830137A06Rik antibody, AIMP1/p43 antibody, Emap2 antibody, Scye1 antibody, scye1 antibody, aminoacyl tRNA synthetase complex interacting multifunctional protein 1 antibody, aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 antibody, aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 S homeolog antibody, AIMP1 antibody, aimp1 antibody, Aimp1 antibody, aimp1.S antibody

Background: SCYE1 is a cytokine that is specifically induced by apoptosis. The release of this cytokine renders the tumor-associated vasculature sensitive to tumor necrosis factor. The precursor of SCYE1 (pro-SCYE1) is identical to the p43 subunit, which is associated with the multi-tRNA synthetase complex. Therefore, pro-SCYE1 may function in binding RNA as part of the tRNA synthetase complex in normal cells and in stimulating inflammatory responses after proteolytic cleavage in tumor cells.

Molecular Weight: 34 kDa (MW of target protein)