RBM9 antibody (Middle Region)
-
- Target See all RBM9 Antibodies
- RBM9 (RNA Binding Motif Protein 9 (RBM9))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RBM9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBM9 antibody was raised against the middle region of RBM9
- Purification
- Affinity purified
- Immunogen
- RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT
- Top Product
- Discover our top product RBM9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBM9 Blocking Peptide, catalog no. 33R-7280, is also available for use as a blocking control in assays to test for specificity of this RBM9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM9 (RNA Binding Motif Protein 9 (RBM9))
- Alternative Name
- RBM9 (RBM9 Products)
- Synonyms
- rta antibody, fox2 antibody, xrbm9 antibody, hrnbp2 antibody, MGC79813 antibody, RBM9 antibody, rbm9a antibody, FOX2 antibody, Fox-2 antibody, HNRBP2 antibody, HRNBP2 antibody, RTA antibody, dJ106I20.3 antibody, fxh antibody, 2810460A15Rik antibody, AA407676 antibody, AI118529 antibody, Fbm2 antibody, Fxh antibody, Hrnbp2 antibody, Rbm9 antibody, rbm9 antibody, zgc:85694 antibody, fox-2 antibody, hnrbp2 antibody, rbfox2 antibody, rbm9-b antibody, rbm9b antibody, RNA binding protein, fox-1 homolog 2 antibody, RNA binding fox-1 homolog 2 antibody, RNA binding fox-1 homolog 2 L homeolog antibody, RNA binding protein, fox-1 homolog (C. elegans) 2 antibody, RNA binding fox-1 homolog 2 S homeolog antibody, RBFOX2 antibody, rbfox2 antibody, rbfox2.L antibody, Rbfox2 antibody, rbfox2.S antibody
- Background
- RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- Intracellular Steroid Hormone Receptor Signaling Pathway, Skeletal Muscle Fiber Development
-