ASB6 antibody (Middle Region)
-
- Target See all ASB6 Antibodies
- ASB6 (Ankyrin Repeat and SOCS Box Containing 6 (ASB6))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ASB6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ASB6 antibody was raised against the middle region of ASB6
- Purification
- Affinity purified
- Immunogen
- ASB6 antibody was raised using the middle region of ASB6 corresponding to a region with amino acids LKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLV
- Top Product
- Discover our top product ASB6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ASB6 Blocking Peptide, catalog no. 33R-5090, is also available for use as a blocking control in assays to test for specificity of this ASB6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ASB6 (Ankyrin Repeat and SOCS Box Containing 6 (ASB6))
- Alternative Name
- ASB6 (ASB6 Products)
- Background
- ASB6 belongs to a family of ankyrin repeat proteins that, along with four other protein families, contain a C-terminal SOCS box motif. Growing evidence suggests that the SOCS box, similar to the F-box, acts as a bridge between specific substrate-binding domains and the more generic proteins that comprise a large family of E3 ubiquitin protein ligases.
- Molecular Weight
- 46 kDa (MW of target protein)
-