SOCS1 antibody (Middle Region)
-
- Target See all SOCS1 Antibodies
- SOCS1 (Suppressor of Cytokine Signaling 1 (SOCS1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SOCS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SOCS1 antibody was raised against the middle region of SOCS1
- Purification
- Affinity purified
- Immunogen
- SOCS1 antibody was raised using the middle region of SOCS1 corresponding to a region with amino acids RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA
- Top Product
- Discover our top product SOCS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SOCS1 Blocking Peptide, catalog no. 33R-8127, is also available for use as a blocking control in assays to test for specificity of this SOCS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOCS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SOCS1 (Suppressor of Cytokine Signaling 1 (SOCS1))
- Alternative Name
- SOCS1 (SOCS1 Products)
- Synonyms
- socs1 antibody, zgc:91868 antibody, jab antibody, cis1 antibody, ssi1 antibody, tip3 antibody, cish1 antibody, ssi-1 antibody, socs-1 antibody, SOCS1 antibody, LOC100228306 antibody, socs1b antibody, CIS1 antibody, CISH1 antibody, JAB antibody, SOCS-1 antibody, SSI-1 antibody, SSI1 antibody, TIP3 antibody, Cish1 antibody, Cish7 antibody, Socs-1 antibody, suppressor of cytokine signaling 1a antibody, suppressor of cytokine signaling 1 antibody, suppressor of cytokine signaling 1 L homeolog antibody, socs1a antibody, socs1 antibody, SOCS1 antibody, socs1.L antibody, Socs1 antibody
- Background
- SOCS1 is a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. SOCS1 functions downstream of cytokine receptors, and takes part in a negative feedback loop to attenuate cytokine signaling. Knockout studies in mice suggested the role of its gene as a modulator of IFN-gamma action, which is required for normal postnatal growth and survival.
- Molecular Weight
- 23 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling, Interferon-gamma Pathway, TLR Signaling, Response to Growth Hormone Stimulus
-