ARF1 antibody (Middle Region)
-
- Target See all ARF1 Antibodies
- ARF1 (ADP-Ribosylation Factor 1 (ARF1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ARF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ARF1 antibody was raised against the middle region of ARF1
- Purification
- Affinity purified
- Immunogen
- ARF1 antibody was raised using the middle region of ARF1 corresponding to a region with amino acids MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA
- Top Product
- Discover our top product ARF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ARF1 Blocking Peptide, catalog no. 33R-6371, is also available for use as a blocking control in assays to test for specificity of this ARF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ARF1 (ADP-Ribosylation Factor 1 (ARF1))
- Alternative Name
- ARF1 (ARF1 Products)
- Synonyms
- wu:fb33e02 antibody, wu:fb78h01 antibody, arf2 antibody, arf-1 antibody, MGC52573 antibody, ADP-RIBOSYLATION FACTOR antibody, ADP-RIBOSYLATION FACTOR 1A antibody, ADP-ribosylation factor 1 antibody, ATARF antibody, ATARF1 antibody, ATARFA1A antibody, F28C11.12 antibody, ARF1 antibody, arf1 antibody, ADP ribosylation factor 1 antibody, ADP-ribosylation factor 1 antibody, ADP ribosylation factor 1 L homeolog antibody, ADP ribosylation factor 5 L homeolog antibody, ADP ribosylation factor 1 pseudogene antibody, adp-ribosylation factor 1 antibody, ARF1 antibody, Arf1 antibody, arf1 antibody, arf1.L antibody, arf5.L antibody, NCU08340 antibody, TRIADDRAFT_63238 antibody, PAAG_08805 antibody, LOC100280562 antibody, LOC100280918 antibody, LOC474591 antibody, CLUG_01013 antibody
- Background
- ADP-ribosylation factor 1 (ARF1) is a member of the human ARF family. The family is composed of small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. These protein, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization.
- Molecular Weight
- 21 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis, Inositol Metabolic Process
-