Adenylate Kinase 3 antibody (N-Term)

Catalog No. ABIN634447

Product Details anti-Adenylate Kinase 3 Antibody

Target: Adenylate Kinase 3 (AK3)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Adenylate Kinase 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AK3 antibody was raised against the N terminal of AK3

Purification: Affinity purified

Immunogen: AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AK3 Blocking Peptide, catalog no. 33R-6011, is also available for use as a blocking control in assays to test for specificity of this AK3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AK3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Adenylate Kinase 3

Target: Adenylate Kinase 3 (AK3)

Alternative Name: AK3 (AK3 Products)

Synonyms: AK3L1 antibody, AK6 antibody, AKL3L antibody, AKL3L1 antibody, FIX antibody, AK4 antibody, AA407498 antibody, AI506714 antibody, AK-3 antibody, Ak3l antibody, Ak3l1 antibody, Akl3l antibody, ak3l1 antibody, sb:cb845 antibody, zgc:64135 antibody, id:ibd3034 antibody, wu:fa02c11 antibody, wu:fc20h08 antibody, AK3 antibody, CG6612 antibody, DAK3 antibody, Dak3 antibody, Dmel\\CG6612 antibody, bs12h03.y1 antibody, MGC114646 antibody, ak6 antibody, adenylate kinase 3 antibody, Adenylate kinase 3 antibody, adenylate kinase 3 L homeolog antibody, AK3 antibody, Ak3 antibody, ak3 antibody, Adk3 antibody, ak3.L antibody, ADK3 antibody

Background: The AK3 protein is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process