RAB5B antibody (N-Term)
-
- Target See all RAB5B Antibodies
- RAB5B (RAB5B, Member RAS Oncogene Family (RAB5B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RAB5B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RAB5 B antibody was raised against the N terminal of RAB5
- Purification
- Affinity purified
- Immunogen
- RAB5 B antibody was raised using the N terminal of RAB5 corresponding to a region with amino acids MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE
- Top Product
- Discover our top product RAB5B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RAB5B Blocking Peptide, catalog no. 33R-6565, is also available for use as a blocking control in assays to test for specificity of this RAB5B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAB5B (RAB5B, Member RAS Oncogene Family (RAB5B))
- Alternative Name
- RAB5B (RAB5B Products)
- Background
- RAB5B play a role in protein transport. RAB5B is probably involved in vesicular traffic.
- Molecular Weight
- 24 kDa (MW of target protein)
-