RAB5B antibody (N-Term)

Catalog No. ABIN634446

Product Details anti-RAB5B Antibody

Target: RAB5B (RAB5B, Member RAS Oncogene Family (RAB5B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB5B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB5 B antibody was raised against the N terminal of RAB5

Purification: Affinity purified

Immunogen: RAB5 B antibody was raised using the N terminal of RAB5 corresponding to a region with amino acids MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB5B Blocking Peptide, catalog no. 33R-6565, is also available for use as a blocking control in assays to test for specificity of this RAB5B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB5B

Target: RAB5B (RAB5B, Member RAS Oncogene Family (RAB5B))

Alternative Name: RAB5B (RAB5B Products)

Synonyms: zgc:76978 antibody, C030027M18Rik antibody, RAB5B, member RAS oncogene family antibody, RAB5B, member RAS oncogene family L homeolog antibody, rab5b antibody, LOC613071 antibody, RAB5B antibody, Rab5b antibody, rab5b.L antibody

Background: RAB5B play a role in protein transport. RAB5B is probably involved in vesicular traffic.

Molecular Weight: 24 kDa (MW of target protein)