RAB38 antibody (N-Term)

Catalog No. ABIN634438

Product Details anti-RAB38 Antibody

Target: RAB38 (RAB38, Member RAS Oncogene Family (RAB38))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB38 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RAB38 antibody was raised against the N terminal of RAB38

Purification: Affinity purified

Immunogen: RAB38 antibody was raised using the N terminal of RAB38 corresponding to a region with amino acids MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB38 Blocking Peptide, catalog no. 33R-6318, is also available for use as a blocking control in assays to test for specificity of this RAB38 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB38

Target: RAB38 (RAB38, Member RAS Oncogene Family (RAB38))

Alternative Name: RAB38 (RAB38 Products)

Synonyms: RAB38 antibody, rab38 antibody, 2310011F14Rik antibody, AU043391 antibody, cht antibody, NY-MEL-1 antibody, rrGTPbp antibody, R antibody, Ruby antibody, RAB38, member RAS oncogene family antibody, RAB38a, member RAS oncogene family antibody, RAB38, member RAS oncogene family S homeolog antibody, RAB38 antibody, rab38a antibody, rab38.S antibody, Rab38 antibody

Background: RAB38 may be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1.

Molecular Weight: 24 kDa (MW of target protein)