Calcyphosine antibody (N-Term)
-
- Target See all Calcyphosine (CAPS) Antibodies
- Calcyphosine (CAPS)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Calcyphosine antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CAPS antibody was raised against the N terminal of CAPS
- Purification
- Affinity purified
- Immunogen
- CAPS antibody was raised using the N terminal of CAPS corresponding to a region with amino acids DAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLA
- Top Product
- Discover our top product CAPS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CAPS Blocking Peptide, catalog no. 33R-1864, is also available for use as a blocking control in assays to test for specificity of this CAPS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Calcyphosine (CAPS)
- Alternative Name
- CAPS (CAPS Products)
- Synonyms
- CAPS1 antibody, Caps antibody, Caps1 antibody, Caps2 antibody, caps1 antibody, MGC84373 antibody, CAPS antibody, calcyphosine antibody, calcium dependent secretion activator antibody, calcyphosine S homeolog antibody, CAPS antibody, Cadps antibody, caps.S antibody, caps antibody, Caps antibody
- Background
- CAPS is a calcium-binding protein, which may play a role in the regulation of ion transport. A similar protein was first described as a potentially important regulatory protein in the dog thyroid and was termed as R2D5 antigen in rabbit.
- Molecular Weight
- 21 kDa (MW of target protein)
-