TP53TG5 antibody (N-Term)

Catalog No. ABIN634430

Product Details anti-TP53TG5 Antibody

Target: TP53TG5 (TP53 Target 5 (TP53TG5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TP53TG5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C20 ORF10 antibody was raised against the N terminal Of C20 rf10

Purification: Affinity purified

Immunogen: C20 ORF10 antibody was raised using the N terminal Of C20 rf10 corresponding to a region with amino acids RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C20ORF10 Blocking Peptide, catalog no. 33R-8050, is also available for use as a blocking control in assays to test for specificity of this C20ORF10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TP53TG5

Target: TP53TG5 (TP53 Target 5 (TP53TG5))

Alternative Name: C20ORF10 (TP53TG5 Products)

Synonyms: TP53TG5 antibody, C20orf10 antibody, CLG01 antibody, TP53 target 5 antibody, TP53TG5 antibody

Background: C20orf10 may play a significant role in p53/TP53-mediating signaling pathway.

Molecular Weight: 32 kDa (MW of target protein)