RASL10A antibody (N-Term)

Catalog No. ABIN634426

Product Details anti-RASL10A Antibody

Target: RASL10A (RAS-Like, Family 10, Member A (RASL10A))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RASL10A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RASL10 A antibody was raised against the N terminal of RASL10

Purification: Affinity purified

Immunogen: RASL10 A antibody was raised using the N terminal of RASL10 corresponding to a region with amino acids PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RASL10A Blocking Peptide, catalog no. 33R-7384, is also available for use as a blocking control in assays to test for specificity of this RASL10A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RASL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RASL10A

Target: RASL10A (RAS-Like, Family 10, Member A (RASL10A))

Alternative Name: RASL10A (RASL10A Products)

Synonyms: RRP22 antibody, 2210403B10Rik antibody, AI852688 antibody, RGD1306100 antibody, RAS like family 10 member A antibody, RAS-like, family 10, member A antibody, RASL10A antibody, Rasl10a antibody

Background: The specific function of RASL10A is not yet known.

Molecular Weight: 22 kDa (MW of target protein)