PLCD1 antibody (N-Term)

Catalog No. ABIN634425

Product Details anti-PLCD1 Antibody

Target: PLCD1 (phospholipase C, delta 1 (PLCD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLCD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLCD1 antibody was raised against the N terminal of PLCD1

Purification: Affinity purified

Immunogen: PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLCD1 Blocking Peptide, catalog no. 33R-2003, is also available for use as a blocking control in assays to test for specificity of this PLCD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLCD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLCD1

Target: PLCD1 (phospholipase C, delta 1 (PLCD1))

Alternative Name: PLCD1 (PLCD1 Products)

Synonyms: NDNC3 antibody, PLC-III antibody, AW212592 antibody, C79986 antibody, Plc1 antibody, phospholipase C delta 1 antibody, phospholipase C, delta 1 antibody, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 antibody, PLCD1 antibody, Plcd1 antibody, LOC790012 antibody

Background: Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.

Molecular Weight: 86 kDa (MW of target protein)

Pathways: WNT Signaling, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process