PLCD1 antibody (N-Term)
-
- Target See all PLCD1 Antibodies
- PLCD1 (phospholipase C, delta 1 (PLCD1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PLCD1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PLCD1 antibody was raised against the N terminal of PLCD1
- Purification
- Affinity purified
- Immunogen
- PLCD1 antibody was raised using the N terminal of PLCD1 corresponding to a region with amino acids DIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
- Top Product
- Discover our top product PLCD1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PLCD1 Blocking Peptide, catalog no. 33R-2003, is also available for use as a blocking control in assays to test for specificity of this PLCD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLCD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLCD1 (phospholipase C, delta 1 (PLCD1))
- Alternative Name
- PLCD1 (PLCD1 Products)
- Synonyms
- NDNC3 antibody, PLC-III antibody, AW212592 antibody, C79986 antibody, Plc1 antibody, phospholipase C delta 1 antibody, phospholipase C, delta 1 antibody, 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 antibody, PLCD1 antibody, Plcd1 antibody, LOC790012 antibody
- Background
- Phosphoinositide-specific phospholipase C (PLC) acts as a signal transducer that generates 2 second messengers, diacylglycerol and inositol 1,4,5-trisphosphate, by hydrolyzing inositol phospholipids. PLC comprises a diverse family of enzymes that differ in structure and tissue distribution.
- Molecular Weight
- 86 kDa (MW of target protein)
- Pathways
- WNT Signaling, Myometrial Relaxation and Contraction, Regulation of Carbohydrate Metabolic Process
-