Pkc beta 1 antibody (N-Term)
-
- Target See all Pkc beta 1 Antibodies
- Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))
-
Binding Specificity
- N-Term
-
Reactivity
- Rat, Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Pkc beta 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PRKCB1 antibody was raised against the N terminal of PRKCB1
- Purification
- Affinity purified
- Immunogen
- PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids CFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
- Top Product
- Discover our top product Pkc beta 1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PRKCB1 Blocking Peptide, catalog no. 33R-1688, is also available for use as a blocking control in assays to test for specificity of this PRKCB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))
- Alternative Name
- PRKCB1 (Pkc beta 1 Products)
- Synonyms
- PKC-beta antibody, PKCB antibody, PRKCB1 antibody, PRKCB2 antibody, A130082F03Rik antibody, PKC-Beta antibody, Pkcb antibody, Prkcb1 antibody, Prkcb2 antibody, PKC antibody, PRKCB_tv2 antibody, protein kinase C beta antibody, protein kinase C, beta antibody, PRKCB antibody, Prkcb antibody
- Background
- Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.
- Molecular Weight
- 77 kDa (MW of target protein)
-