Pkc beta 1 antibody (N-Term)

Catalog No. ABIN634421

Product Details anti-Pkc beta 1 Antibody

Target: Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))

Binding Specificity: N-Term

Reactivity: Rat, Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Pkc beta 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRKCB1 antibody was raised against the N terminal of PRKCB1

Purification: Affinity purified

Immunogen: PRKCB1 antibody was raised using the N terminal of PRKCB1 corresponding to a region with amino acids MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKCB1 Blocking Peptide, catalog no. 33R-5625, is also available for use as a blocking control in assays to test for specificity of this PRKCB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Pkc beta 1

Target: Pkc beta 1 (Protein Kinase C, beta 1 (Pkc beta 1))

Alternative Name: PRKCB1 (Pkc beta 1 Products)

Synonyms: PKC-beta antibody, PKCB antibody, PRKCB1 antibody, PRKCB2 antibody, A130082F03Rik antibody, PKC-Beta antibody, Pkcb antibody, Prkcb1 antibody, Prkcb2 antibody, PKC antibody, PRKCB_tv2 antibody, protein kinase C beta antibody, protein kinase C, beta antibody, PRKCB antibody, Prkcb antibody

Background: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.

Molecular Weight: 77 kDa (MW of target protein)