RHOBTB1 antibody (Middle Region)

Catalog No. ABIN634415

Product Details anti-RHOBTB1 Antibody

Target: RHOBTB1 (rho-Related BTB Domain Containing 1 (RHOBTB1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHOBTB1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: RHOBTB1 antibody was raised against the middle region of RHOBTB1

Purification: Affinity purified

Immunogen: RHOBTB1 antibody was raised using the middle region of RHOBTB1 corresponding to a region with amino acids DNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDIALNKHRSRRKWCFWN

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHOBTB1 Blocking Peptide, catalog no. 33R-2087, is also available for use as a blocking control in assays to test for specificity of this RHOBTB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOBTB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHOBTB1

Target: RHOBTB1 (rho-Related BTB Domain Containing 1 (RHOBTB1))

Alternative Name: RHOBTB1 (RHOBTB1 Products)

Synonyms: 1700008H16Rik antibody, 3110048G13Rik antibody, AI173445 antibody, AI573858 antibody, AV350930 antibody, Rho related BTB domain containing 1 antibody, Rho-related BTB domain containing 1 antibody, Rho related BTB domain containing 1 S homeolog antibody, RHOBTB1 antibody, rhobtb1 antibody, rhobtb1.S antibody, Rhobtb1 antibody

Background: RHOBTB1 belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system.

Molecular Weight: 77 kDa (MW of target protein)