Pleckstrin antibody (N-Term)
-
- Target See all Pleckstrin (PLEK) Antibodies
- Pleckstrin (PLEK)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Pleckstrin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PLEK antibody was raised against the N terminal of PLEK
- Purification
- Affinity purified
- Immunogen
- PLEK antibody was raised using the N terminal of PLEK corresponding to a region with amino acids MEPKRIREGYLVKKGSVFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPL
- Top Product
- Discover our top product PLEK Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PLEK Blocking Peptide, catalog no. 33R-5943, is also available for use as a blocking control in assays to test for specificity of this PLEK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Pleckstrin (PLEK)
- Alternative Name
- PLEK (PLEK Products)
- Background
- PLEK is a major protein kinase C substrate of platelets, its exact function is not known.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of Cell Size, Regulation of Carbohydrate Metabolic Process
-