ASB8 antibody (N-Term)

Catalog No. ABIN634410

Product Details anti-ASB8 Antibody

Target: ASB8 (Ankyrin Repeat and SOCS Box Containing 8 (ASB8))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASB8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ASB8 antibody was raised against the N terminal of ASB8

Purification: Affinity purified

Immunogen: ASB8 antibody was raised using the N terminal of ASB8 corresponding to a region with amino acids MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASB8 Blocking Peptide, catalog no. 33R-6512, is also available for use as a blocking control in assays to test for specificity of this ASB8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASB8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASB8

Target: ASB8 (Ankyrin Repeat and SOCS Box Containing 8 (ASB8))

Alternative Name: ASB8 (ASB8 Products)

Synonyms: wu:fd16d08 antibody, zgc:64033 antibody, 4930539L19Rik antibody, AI788835 antibody, C430011H06Rik antibody, ankyrin repeat and SOCS box containing 8 antibody, ankyrin repeat and SOCS box-containing 8 antibody, ASB8 antibody, asb8 antibody, Asb8 antibody

Background: ASB8 may be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Molecular Weight: 32 kDa (MW of target protein)