DUSP10 antibody (N-Term)

Catalog No. ABIN634409

Product Details anti-DUSP10 Antibody

Target: DUSP10 (Dual Specificity Phosphatase 10 (DUSP10))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DUSP10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DUSP10 antibody was raised against the N terminal of DUSP10

Purification: Affinity purified

Immunogen: DUSP10 antibody was raised using the N terminal of DUSP10 corresponding to a region with amino acids MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DUSP10 Blocking Peptide, catalog no. 33R-6340, is also available for use as a blocking control in assays to test for specificity of this DUSP10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DUSP10

Target: DUSP10 (Dual Specificity Phosphatase 10 (DUSP10))

Alternative Name: DUSP10 (DUSP10 Products)

Synonyms: DUSP10 antibody, MKP-5 antibody, MKP5 antibody, 2610306G15Rik antibody, AI158871 antibody, Mkp-5 antibody, Mkp5 antibody, dual specificity phosphatase 10 antibody, DUSP10 antibody, Dusp10 antibody

Background: Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues.

Molecular Weight: 16 kDa (MW of target protein)