DUSP10 antibody (N-Term)
-
- Target See all DUSP10 Antibodies
- DUSP10 (Dual Specificity Phosphatase 10 (DUSP10))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DUSP10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DUSP10 antibody was raised against the N terminal of DUSP10
- Purification
- Affinity purified
- Immunogen
- DUSP10 antibody was raised using the N terminal of DUSP10 corresponding to a region with amino acids MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE
- Top Product
- Discover our top product DUSP10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DUSP10 Blocking Peptide, catalog no. 33R-6340, is also available for use as a blocking control in assays to test for specificity of this DUSP10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DUSP10 (Dual Specificity Phosphatase 10 (DUSP10))
- Alternative Name
- DUSP10 (DUSP10 Products)
- Background
- Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues.
- Molecular Weight
- 16 kDa (MW of target protein)
-