SOCS7 antibody (N-Term)

Catalog No. ABIN634408

Product Details anti-SOCS7 Antibody

Target: SOCS7 (Suppressor of Cytokine Signaling 7 (SOCS7))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SOCS7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SOCS7 antibody was raised against the N terminal of SOCS7

Purification: Affinity purified

Immunogen: SOCS7 antibody was raised using the N terminal of SOCS7 corresponding to a region with amino acids LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SOCS7 Blocking Peptide, catalog no. 33R-4853, is also available for use as a blocking control in assays to test for specificity of this SOCS7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOCS7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SOCS7

Target: SOCS7 (Suppressor of Cytokine Signaling 7 (SOCS7))

Alternative Name: SOCS7 (SOCS7 Products)

Synonyms: NAP4 antibody, NCKAP4 antibody, SOCS4 antibody, SOCS6 antibody, 2310063P06Rik antibody, C85125 antibody, Nap4 antibody, GB13951 antibody, zgc:175115 antibody, SOCS7 antibody, socs7 antibody, suppressor of cytokine signaling 7 antibody, suppressor of cytokine signaling antibody, SOCS7 antibody, Socs7 antibody, LOC413772 antibody, socs7 antibody

Background: SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. SOCS7 functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. SOCS7 inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Molecular Weight: 64 kDa (MW of target protein)