RGS4 antibody (C-Term)

Catalog No. ABIN634407

Product Details anti-RGS4 Antibody

Target: RGS4 (Regulator of G-Protein Signaling 4 (RGS4))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RGS4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RGS4 antibody was raised against the C terminal of RGS4

Purification: Affinity purified

Immunogen: RGS4 antibody was raised using the C terminal of RGS4 corresponding to a region with amino acids EAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RGS4 Blocking Peptide, catalog no. 33R-2276, is also available for use as a blocking control in assays to test for specificity of this RGS4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RGS4

Target: RGS4 (Regulator of G-Protein Signaling 4 (RGS4))

Alternative Name: RGS4 (RGS4 Products)

Synonyms: RGP4 antibody, SCZD9 antibody, AA004315 antibody, AA597169 antibody, ESTM48 antibody, ESTM50 antibody, regulator of G protein signaling 4 antibody, regulator of G-protein signaling 4 antibody, RGS4 antibody, Rgs4 antibody

Background: Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein negatively regulates signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling